• LL-37 5 mg – 10 Vial Box (50mg Total)
  • LL-37 5 mg – 10 Vial Box (50mg Total)
1 2

LL-37 5 mg – 10 Vial Box (50mg Total)

LL-37 5 mg – 10 Vial Box (50mg Total)

$266.40 USD
$266.40 USD
Sale Sold out

Description

Description

LL-37 is a natural antimicrobial peptide produced by the human immune system to fight bacteria, viruses, and fungi. It works by disrupting the membranes of harmful microbes while promoting wound healing and modulating inflammation. Research shows it offers strong broad-spectrum protection and supports tissue repair in various studies.

Minimum order quantity: one box (10 vials x 5 mg).

Note: Product images show branded labels for illustration purposes only. All peptides are shipped in wholesale, unbranded packaging. You can see an actual example photo of the peptide vials and container above.

 

 

Specifications

Additional information

Purity

≥99.0%
Molar Mass

4493.34 g/mol
Molecular Formula

C₂₀₅H₃₄₀N₆₀O₅₃
Sequence

[LL-37, 37 aa]
Cost per vial $

33.3

Research

  1. Fabisiak, Adam, Natalia Murawska, and Jakub Fichna. "LL-37: Cathelicidin-related antimicrobial peptide with pleiotropic activity." Pharmacological Reports 68.4 (2016): 802-808.
  2. Burton, Matthew F., and Patrick G. Steel. "The chemistry and biology of LL-37." Natural product reports 26.12 (2009): 1572-1584.
  3. Bowdish, Dawn ME, et al. "Impact of LL-37 on anti-infective immunity." Journal of leukocyte biology 77.4 (2005): 451-459.
  4. Burton, Matthew F., and Patrick G. Steel. "The chemistry and biology of LL-37." Natural product reports 26.12 (2009): 1572-1584.

Testing Docs

Related products

Back To Top

Product features

Materials and care

Merchandising tips

View full details
Product Product subtotal Quantity Price Product subtotal
LL-37 5 mg – 10 Vial Box (50mg Total)
LL-37 5 mg – 10 Vial Box (50mg Total)THY10
LL-37 5 mg – 10 Vial Box (50mg Total)THY10
$266.40/ea		 $0.00
$266.40/ea $0.00